Antibody Format : sdAb
Fusion Protein : GB1
Antigen : Focal adhesion kinase 1
UniProtKB : Q05397
Species : HUMAN
Species Cross-reactivity :
Remarks :
Applications : Dilution
● ELISA
● WB no
● IF _
Description :
● Antigen Preparation : The 38.3 kDa C-terminal human protein domain (707-1052 aa) was expressed in E.coli and purified by his affinity purification.
● Antigen Amino Acid Sequence :
GSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
Abbrevications and cautions :
● scFv : human single chain antibody (naive sequences)
● sdAb : camel single domain antibody (fully synthetic sequences)
● GB1 fusion : IgG binding domain of streptococcal protein G
● IgG Fc fusion : human, mouse or rabbit IgG Fc (contains hinge, CH1, CH2 domain)
● Applications : yes/no or _ (not determined)