Antibody Format : sdAb

Fusion Protein : GB1

Antigen : Histone H2A type 1

UniProtKB : P0C0S8

Species : HUMAN

Species Cross-reactivity : human, mouse

Remarks :

Applications : Dilution

○ ELISA

○ WB 1/1,000

○ IF 1/200

 

Description

Antigen Preparation : The 14 kDa human full length protein was expressed in E.coli and purified by his affinity purification.

Antigen Amino Acid Sequence : 

SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK

 

Abbrevications and cautions

○ scFv : human single chain antibody (naive sequences)

○ sdAb : camel single domain antibody (fully synthetic sequences)

○ GB1 fusion : IgG binding domain of streptococcal protein G

○ IgG Fc fusion : human, mouse or rabbit IgG Fc (contains hinge, CH1, CH2 domain)

○ Applications : yes/no or _ (not determined)​