Antibody Format : sdAb
Fusion Protein : GB1
Antigen : Interleukin-6
UniProtKB : P05231
Species : HUMAN
Species Cross-reactivity :
Remarks :
Applications : Dilution
○ ELISA
○ WB -
○ IF -
Description
Antigen Preparation : The 20.8 kDa human IL6 with 6xhis tag at the N-terminal end was expressed in E.coli and purified by his affinity purification.
Antigen Amino Acid Sequence :
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDM
Abbrevications and cautions
○ scFv : human single chain antibody (naive sequences)
○ sdAb : camel single domain antibody (fully synthetic sequences)
○ GB1 fusion : IgG binding domain of streptococcal protein G
○ IgG Fc fusion : human, mouse or rabbit IgG Fc (contains hinge, CH1, CH2 domain)
○ Applications : yes/no or _ (not determined)