Antibody Format : sdAb
Fusion Protein : GB1
Antigen : Oncostatin-M
UniProtKB : P13725
Species : HUMAN
Species Cross-reactivity :
Remarks :
Applications : Dilution
○ ELISA
○ WB _
○ IF _
Description
Antigen Preparation : The 22 kDa human Oncostatin-M with 6xhis tag at the N-terminal end was expressed in E.coli and purified by his affinity purification.
Antigen Amino Acid Sequence :
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSR
Abbrevications and cautions
○ scFv : human single chain antibody (naive sequences)
○ sdAb : camel single domain antibody (fully synthetic sequences)
○ GB1 fusion : IgG binding domain of streptococcal protein G
○ IgG Fc fusion : human, mouse or rabbit IgG Fc (contains hinge, CH1, CH2 domain)
○ Applications : yes/no or _ (not determined)